Anti-E3 ubiquitin-protein ligase MUL1 antibody

Name Anti-E3 ubiquitin-protein ligase MUL1 antibody
Supplier Abcam
Catalog ab84067
Prices $385.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF ICC/IF IHC-P
Species Reactivities Mouse, Rat, Human, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog
Antigen Synthetic peptide corresponding to a region within internal sequence amino acids 215-264 (GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYL Q) of Human C1orf166 (NP_078820)
Blocking Peptide Human E3 ubiquitin-protein ligase MUL1 peptide
Description Rabbit Polyclonal
Gene MUL1
Conjugate Unconjugated
Supplier Page Shop

Product images


Product References