Anti-EMSY antibody

• Supplier: Abcam
• Catalog: ab4579
• Prices: $376.00
• Sizes: 100 µg
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Applications: ICC/IF ICC/IF WB ICC/IF
• Species Reactivities: Human
• Antigen: Recombinant fragment corresponding to EMSY ENT domain: MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLG ELSKVLSISTER HRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRL , corresponding to amino acids 1-100 of Human EMSY - FPLC purified
• Description: Goat Polyclonal
• Gene: C11orf30
• Conjugate: Unconjugated

Product images

Lanes 1 - 2 : Anti-EMSY antibody (ab4579) at 1 µg/mlLane 3 : Anti-EMSY antibody (ab123) at 1 µg/mlLane 1 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell LysateLane 2 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell LysateLane 3 : MCF7 (Human breast adenocarcinoma cell line) Whole Cell LysateLysates/proteins at 10 µg per lane.SecondaryLanes 1 - 2 : Rabbit polyclonal to Goat IgG - H&L - Pre-Adsorbed (HRP) at 1/10000 dilutionLane 3 : Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/50000 dilutiondeveloped using the ECL techniquePerformed under reducing conditions.