Anti-Ephrin A2 antibody
| Name | Anti-Ephrin A2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116035 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Chicken, Guinea Pig, Bovine |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 76-125 ( YGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLK ) of Human Ephrin A2 (NP_001396) |
| Description | Rabbit Polyclonal |
| Gene | EFNA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Ephrin A2 antibody (ab116035) at 1 µg/ml + placenta lysate at 10 µg