Anti-Estrogen Inducible Protein pS2 antibody
| Name | Anti-Estrogen Inducible Protein pS2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98875 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 35-84, (PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECE F) of Human Estrogen Inducible Protein pS2 (NP_003216) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TFF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Estrogen Inducible Protein pS2 antibody (ab98875) at 1 µg/ml + Human fetal stomach lysate at 10 µg