Anti-Estrogen Inducible Protein pS2 antibody [pS2.1]

• Supplier: Abcam
• Catalog: ab3079
• Prices: $370.00
• Sizes: 500 µl
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: pS2.1
• Applications: IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptide: KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF , corresponding to C terminal amino acids 54-84 of Human Estrogen Inducible Protein pS2 Run BLAST with Run BLAST with
• Description: Mouse Monoclonal
• Gene: TFF1
• Conjugate: Unconjugated