Anti-Exonuclease 1 antibody
| Name | Anti-Exonuclease 1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab95012 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IP |
| Species Reactivities | Human, Chimpanzee, Ape, Orangutan |
| Antigen | Immunogen maps to a region within: LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK , corresponding to amino acids 725-775 of Human Exonuclease 1 (NP_006018 |
| Description | Rabbit Polyclonal |
| Gene | EXO1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-Exonuclease 1 antibody (ab95012) at 0.1 µg/mlLane 1 : HeLa whole cell lysate at 50 µgLane 2 : HeLa whole cell lysate at 15 µgLane 3 : HeLa whole cell lysate at 5 µgLane 4 : 293T whole cell lysate at 50 µgdeveloped using the ECL technique
ab95012 at 1 µg/ml detecting Exonuclease 1 in HeLa whole cell lysate by WB following IP. Lane 1: ab95012 with 10µg/mg of lysate Lane 2: IP with an antibody which recognizes an downstream epitope of Exonuclease 1 Lane 3: control IgG. In each case, 1 mg of lysate was used for IP and 20% of the IP was loaded. Detection: Chemiluminescence with an exposure time of 30 seconds