Name | Anti-Exonuclease 1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab95012 |
Prices | $370.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB IP |
Species Reactivities | Human, Chimpanzee, Ape, Orangutan |
Antigen | Immunogen maps to a region within: LSHFSKKDTPLRNKVPGLYKSSSADSLSTTKIKPLGPARASGLSKKPASI QK , corresponding to amino acids 725-775 of Human Exonuclease 1 (NP_006018 |
Description | Rabbit Polyclonal |
Gene | EXO1 |
Conjugate | Unconjugated |
Supplier Page | Shop |