Anti-FBXW8 antibody
| Name | Anti-FBXW8 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85647 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 503-552 (MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRH R) of Human FBXW8, NP_699179 |
| Description | Rabbit Polyclonal |
| Gene | FBXW8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-FBXW8 antibody (ab85647) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution