Anti-FOXC1 antibody
| Name | Anti-FOXC1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94650 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Cat |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 36-85 (GYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYI A) of Human FOXC1 (NP_001444) |
| Description | Rabbit Polyclonal |
| Gene | FOXC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
