Anti-Frataxin antibody
| Name | Anti-Frataxin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113992 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 106-155 ( EFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLS ) of Rat Frataxin (XP_001078791) |
| Description | Rabbit Polyclonal |
| Gene | FXN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Frataxin antibody (ab113992) at 1 µg/ml + Rat heart lysate at 10 µg