Name | Anti-Frataxin antibody |
---|---|
Supplier | Abcam |
Catalog | ab113992 |
Prices | $376.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast, Drosophila, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 106-155 ( EFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLS ) of Rat Frataxin (XP_001078791) |
Description | Rabbit Polyclonal |
Gene | FXN |
Conjugate | Unconjugated |
Supplier Page | Shop |