Anti-GCHFR antibody
| Name | Anti-GCHFR antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86384 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 2 - 51 ( PYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDD ) of Human GCHFR (NP_005249) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | GCHFR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-GCHFR antibody (ab86384) at 1 µg/ml + Human fetal liver lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution