| Name | WNK3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5768 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | WNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | WNK3 Blocking Peptide |
| Description | Rabbit polyclonal WNK3 antibody raised against the N terminal of WNK3 |
| Gene | WNK3 |
| Supplier Page | Shop |