| Name | UXT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1125 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | UXT Blocking Peptide |
| Description | Rabbit polyclonal UXT antibody raised against the N terminal of UXT |
| Gene | UXT |
| Supplier Page | Shop |