| Name | ROBO2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6457 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ROBO2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | ROBO2 Blocking Peptide |
| Description | Rabbit polyclonal ROBO2 antibody |
| Gene | ROBO1 |
| Supplier Page | Shop |