Klotho antibody

Name Klotho antibody
Supplier Fitzgerald
Catalog 70R-7521
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Klotho antibody was raised using the middle region of KL corresponding to a region with amino acids GRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
Purity/Format Affinity purified
Blocking Peptide Klotho Blocking Peptide
Description Rabbit polyclonal KL antibody raised against the middle region of KL
Gene KL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.