| Name | NR1H2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1007 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | NR1H2 antibody was raised using the middle region of NR1H2 corresponding to a region with amino acids MIQQLVAAQLQCNKRSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NR1H2 Blocking Peptide |
| Description | Rabbit polyclonal NR1H2 antibody raised against the middle region of NR1H2 |
| Gene | NR1H2 |
| Supplier Page | Shop |