ST8SIA4 antibody

Name ST8SIA4 antibody
Supplier Fitzgerald
Catalog 70R-5238
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ST8SIA4 antibody was raised using the middle region of ST8SIA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM
Purity/Format Affinity purified
Blocking Peptide ST8SIA4 Blocking Peptide
Description Rabbit polyclonal ST8SIA4 antibody raised against the middle region of ST8SIA4
Gene ST8SIA4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.