| Name | SLC46A1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6536 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLC46A1 Blocking Peptide |
| Description | Rabbit polyclonal SLC46A1 antibody |
| Gene | SLC46A1 |
| Supplier Page | Shop |