| Name | NOLC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1622 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Arabidopsis thaliana, Drosophila |
| Antigen | NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NOLC1 Blocking Peptide |
| Description | Rabbit polyclonal NOLC1 antibody raised against the C terminal of NOLC1 |
| Gene | RBL2 |
| Supplier Page | Shop |