| Name | TYMS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2717 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME |
| Purity/Format | Affinity purified |
| Blocking Peptide | TYMS Blocking Peptide |
| Description | Rabbit polyclonal TYMS antibody raised against the C terminal of TYMS |
| Gene | TYMS |
| Supplier Page | Shop |