Name | MYD88 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5825 |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MYD88 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP |
Purity/Format | Affinity purified |
Blocking Peptide | MYD88 Blocking Peptide |
Description | Rabbit polyclonal MYD88 antibody |
Gene | MYD88 |
Supplier Page | Shop |