| Name | PERLD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7183 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PERLD1 Blocking Peptide |
| Description | Rabbit polyclonal PERLD1 antibody raised against the N terminal of PERLD1 |
| Gene | CACNB2 |
| Supplier Page | Shop |