| Name | APBB1IP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4095 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | APBB1IP antibody was raised using the N terminal Of Apbb1Ip corresponding to a region with amino acids LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG |
| Purity/Format | Affinity purified |
| Blocking Peptide | APBB1IP Blocking Peptide |
| Description | Rabbit polyclonal APBB1IP antibody raised against the N terminal Of Apbb1Ip |
| Gene | APBB1IP |
| Supplier Page | Shop |