| Name | ORC6L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5606 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ORC6L antibody was raised using a synthetic peptide corresponding to a region with amino acids VEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ORC6L Blocking Peptide |
| Description | Rabbit polyclonal ORC6L antibody |
| Gene | ORC6 |
| Supplier Page | Shop |