| Name | TSHR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1187 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | TSHR Blocking Peptide |
| Description | Rabbit polyclonal TSHR antibody raised against the N terminal of TSHR |
| Gene | TSHR |
| Supplier Page | Shop |