CACNB2 antibody

Name CACNB2 antibody
Supplier Fitzgerald
Catalog 70R-1508
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS
Purity/Format Total IgG Protein A purified
Blocking Peptide CACNB2 Blocking Peptide
Description Rabbit polyclonal CACNB2 antibody raised against the middle region of CACNB2
Gene CACNB2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.