| Name | PABPC1L2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4937 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PABPC1L2A antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL |
| Purity/Format | Affinity purified |
| Blocking Peptide | PABPC1L2A Blocking Peptide |
| Description | Rabbit polyclonal PABPC1L2A antibody |
| Gene | PABPC1 |
| Supplier Page | Shop |