NR5A1 antibody

Name NR5A1 antibody
Supplier Fitzgerald
Catalog 70R-1005
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
Purity/Format Affinity Purified
Blocking Peptide NR5A1 Blocking Peptide
Description Affinity purified Rabbit polyclonal NR5A1 antibody raised against the middle region of NR5A1
Gene NR5A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.