ANKRD2 antibody

Name ANKRD2 antibody
Supplier Fitzgerald
Catalog 70R-3378
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL
Purity/Format Affinity purified
Blocking Peptide ANKRD2 Blocking Peptide
Description Rabbit polyclonal ANKRD2 antibody
Gene ANKRD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.