HMGCL antibody

Name HMGCL antibody
Supplier Fitzgerald
Catalog 70R-5397
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL
Purity/Format Affinity purified
Blocking Peptide HMGCL Blocking Peptide
Description Rabbit polyclonal HMGCL antibody
Gene HMGCL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.