| Name | NUP50 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3057 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED |
| Purity/Format | Affinity purified |
| Blocking Peptide | NUP50 Blocking Peptide |
| Description | Rabbit polyclonal NUP50 antibody raised against the C terminal of NUP50 |
| Gene | NUP50 |
| Supplier Page | Shop |