| Name | CUGBP2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1395 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | CUGBP2 antibody was raised using the N terminal of CUGBP2 corresponding to a region with amino acids VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CUGBP2 Blocking Peptide |
| Description | Rabbit polyclonal CUGBP2 antibody raised against the N terminal of CUGBP2 |
| Gene | CELF2 |
| Supplier Page | Shop |