SH3KBP1 antibody

Name SH3KBP1 antibody
Supplier Fitzgerald
Catalog 70R-4573
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SH3KBP1 antibody was raised using the N terminal of SH3KBP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
Purity/Format Affinity purified
Blocking Peptide SH3KBP1 Blocking Peptide
Description Rabbit polyclonal SH3KBP1 antibody raised against the N terminal of SH3KBP1
Gene SH3KBP1
Supplier Page Shop