| Name | ST6GALNAC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7277 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ST6GALNAC4 antibody was raised using the middle region of ST6GALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST6GALNAC4 Blocking Peptide |
| Description | Rabbit polyclonal ST6GALNAC4 antibody raised against the middle region of ST6GALNAC4 |
| Gene | ST6GALNAC4 |
| Supplier Page | Shop |