| Name | Cytokeratin 8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3292 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | Cytokeratin 8 antibody was raised using the N terminal of KRT8 corresponding to a region with amino acids MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGL |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cytokeratin 8 Blocking Peptide |
| Description | Rabbit polyclonal Cytokeratin 8 antibody raised against the N terminal of KRT8 |
| Gene | KRT8 |
| Supplier Page | Shop |