| Name | ApoBEC3F antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4925 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ApoBEC3F antibody was raised using the C terminal of APOBEC3F corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE |
| Purity/Format | Affinity purified |
| Blocking Peptide | ApoBEC3F Blocking Peptide |
| Description | Rabbit polyclonal ApoBEC3F antibody raised against the C terminal of APOBEC3F |
| Gene | APOBEC3F |
| Supplier Page | Shop |