CPS1 antibody

Name CPS1 antibody
Supplier Fitzgerald
Catalog 70R-1111
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
Purity/Format Total IgG Protein A purified
Blocking Peptide CPS1 Blocking Peptide
Description Rabbit polyclonal CPS1 antibody raised against the N terminal of CPS1
Gene CYP21A2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.