Name | RGS20 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1143 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | RGS20 antibody was raised using the middle region of RGS20 corresponding to a region with amino acids NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | RGS20 Blocking Peptide |
Description | Rabbit polyclonal RGS20 antibody raised against the middle region of RGS20 |
Gene | RGS20 |
Supplier Page | Shop |