| Name | OASL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5888 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OASL antibody was raised using the middle region of OASL corresponding to a region with amino acids RGTAEPITVTIVPAYRALGPSLPNSQPPPEVYVSLIKACGGPGNFCPSFS |
| Purity/Format | Affinity purified |
| Blocking Peptide | OASL Blocking Peptide |
| Description | Rabbit polyclonal OASL antibody raised against the middle region of OASL |
| Gene | OASL |
| Supplier Page | Shop |