| Name | KIF5A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2074 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | KIF5A antibody was raised using the middle region of KIF5A corresponding to a region with amino acids LEESYDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESH |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF5A Blocking Peptide |
| Description | Rabbit polyclonal KIF5A antibody raised against the middle region of KIF5A |
| Gene | KIF5A |
| Supplier Page | Shop |