Granzyme A antibody

Name Granzyme A antibody
Supplier Fitzgerald
Catalog 70R-5926
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Granzyme A antibody was raised using a synthetic peptide corresponding to a region with amino acids TREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNS
Purity/Format Affinity purified
Blocking Peptide Granzyme A Blocking Peptide
Description Rabbit polyclonal Granzyme A antibody
Gene GZMA
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.