| Name | NR2F6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1929 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | NR2F6 antibody was raised using the N terminal of NR2F6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV |
| Purity/Format | Affinity purified |
| Blocking Peptide | NR2F6 Blocking Peptide |
| Description | Rabbit polyclonal NR2F6 antibody raised against the N terminal of NR2F6 |
| Gene | NR2F6 |
| Supplier Page | Shop |