| Name | KIF23 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1608 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KIF23 Blocking Peptide |
| Description | Rabbit polyclonal KIF23 antibody raised against the N terminal of KIF23 |
| Gene | KIF23 |
| Supplier Page | Shop |