| Name | DGKA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5806 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | DGKA Blocking Peptide |
| Description | Rabbit polyclonal DGKA antibody raised against the N terminal of DGKA |
| Gene | DGKQ |
| Supplier Page | Shop |