Name | CLIC2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1511 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CLIC2 antibody was raised using the middle region of CLIC2 corresponding to a region with amino acids HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CLIC2 Blocking Peptide |
Description | Rabbit polyclonal CLIC2 antibody raised against the middle region of CLIC2 |
Gene | CLIC2 |
Supplier Page | Shop |