| Name | MICA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1705 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MICA antibody was raised using the middle region of MICA corresponding to a region with amino acids LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MICA Blocking Peptide |
| Description | Rabbit polyclonal MICA antibody raised against the middle region of MICA |
| Gene | MICA |
| Supplier Page | Shop |