GUCA1A antibody

Name GUCA1A antibody
Supplier Fitzgerald
Catalog 70R-2671
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GUCA1A antibody was raised using a synthetic peptide corresponding to a region with amino acids LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK
Purity/Format Affinity purified
Blocking Peptide GUCA1A Blocking Peptide
Description Rabbit polyclonal GUCA1A antibody
Gene GUCA1A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.