| Name | RAGE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5978 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | RAGE antibody was raised using the C terminal of AGER corresponding to a region with amino acids PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RAGE Blocking Peptide |
| Description | Rabbit polyclonal AGER antibody raised against the C terminal of AGER |
| Gene | AGER |
| Supplier Page | Shop |