| Name | PSME3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1072 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PSME3 Blocking Peptide |
| Description | Rabbit polyclonal PSME3 antibody raised against the C terminal of PSME3 |
| Gene | PSME3 |
| Supplier Page | Shop |