| Name | BCKDK antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3675 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD |
| Purity/Format | Affinity purified |
| Blocking Peptide | BCKDK Blocking Peptide |
| Description | Rabbit polyclonal BCKDK antibody raised against the N terminal of BCKDK |
| Gene | BCKDK |
| Supplier Page | Shop |