| Name | SIGLEC6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6185 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| Purity/Format | Affinity purified |
| Blocking Peptide | SIGLEC6 Blocking Peptide |
| Description | Rabbit polyclonal SIGLEC6 antibody raised against the C terminal of SIGLEC6 |
| Gene | SIGLEC6 |
| Supplier Page | Shop |